PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01964.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 349aa    MW: 39626.5 Da    PI: 5.2214
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01964.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.51.2e-48141401128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              l pGfrF+Ptd el+++yL++k+eg+++++  vi+ev+iyk+ePwdLp ++  ++e+ew++F+ r +ky++g++++rat+ gyWka
  Rsa1.0_01964.1_g00004.1  14 LFPGFRFSPTDVELISYYLRRKIEGDENSV-AVIAEVEIYKFEPWDLPgESKLKSENEWFYFCARGRKYPHGSQSRRATELGYWKA 98 
                              579************************999.89***************543334678***************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tgk+++v+s +++ vg+k+tLvf+ grap+ge+t+W+mhey +
  Rsa1.0_01964.1_g00004.1  99 TGKERSVKS-GNQIVGTKRTLVFHIGRAPRGERTEWIMHEYCI 140
                              *********.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.12E-546155IPR003441NAC domain
PROSITE profilePS5100552.85114156IPR003441NAC domain
PfamPF023652.2E-2416139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MSKEAEMSIA VSALFPGFRF SPTDVELISY YLRRKIEGDE NSVAVIAEVE IYKFEPWDLP  60
GESKLKSENE WFYFCARGRK YPHGSQSRRA TELGYWKATG KERSVKSGNQ IVGTKRTLVF  120
HIGRAPRGER TEWIMHEYCI HGASQDALVV CRLRKNADFR ASSSQRQMED GLVQDYEYVG  180
QTGDGSEREK KSYLVDEEPE LQISNGGDIA ESSNVVEYQD DTNDDCYAEI LNDDIIKLDE  240
EAVKANQAFR PNYPTQQETI FTEASSSKQM LECGMKKESK QTMNSYALFK IMNGSTTASS  300
SGWKIPNPLT HIKKDDSQRV TKNVLATTLF LTILIMSVLF TVLTARDRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-431316619174NAC domain-containing protein 19
3swp_C3e-431316619174NAC domain-containing protein 19
3swp_B3e-431316619174NAC domain-containing protein 19
3swp_A3e-431316619174NAC domain-containing protein 19
3swm_D3e-431316619174NAC domain-containing protein 19
3swm_C3e-431316619174NAC domain-containing protein 19
3swm_B3e-431316619174NAC domain-containing protein 19
3swm_A3e-431316619174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634548.10.0PREDICTED: NAC domain-containing protein 40 isoform X1
RefseqXP_013690731.10.0PREDICTED: NAC domain-containing protein 40-like
SwissprotQ9XIN70.0NAC40_ARATH; NAC domain-containing protein 40
TrEMBLA0A0D3BUG40.0A0A0D3BUG4_BRAOL; Uncharacterized protein
STRINGBra012024.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM104532533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.10.0NTM1-like 8